>3opy_L mol:protein length:351  6-phosphofructo-1-kinase gamma-subunit
MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFS
RKNDNAPVDKLLTNYYNNYEVNVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDL
PLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPEQYRSSRWEDKVKGPALA
NRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGT
TKKIDLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEG
IPAFRRHEIANFLKKRKTPKNADELIFKYVGRWNICYQKKFHQGNISIHQISGYLD
>3opy_F mol:protein length:941  6-phosphofructo-1-kinase beta-subunit
MPDASLFNGTSFITLFAPNISLLQASIDFYTNFLGFAIRKNSNQKLFWLQLEEDQNNVS
IQLILDPEHAASVSQIDQNIRNLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHP
VQQSPNEISPFEVYTVDPLGSLIGFSGFKNPFAVNERSLLPKVSEEKAYRAEDDSEKLL
NPVRKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQ
WHDVRGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRF
RSEWPSLIEELLQTEQISQQQFNTHQNLNICGAVGSIDNDMSSTDATIGAFSSLDRICR
AIDYIDATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEKPASSREWQDQMCD
IVGKHRARGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGT
AVAFDRIYATLQGVEAVNAVLECDADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIE
SRNFKKAISLRDSEFVEHMKNFISTNSADHVPPSLPLEKRKKIAIINVGAPAGGMNSAV
YSMATYCMSRGHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIGTNRTLPNDA
DIGMIAYFFEKYGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPG
TEYSLGSDTCLNSFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISY
VPEEGISLAQLEMDINSLKESFANDQGKTKSGRLILKSENASKVLTTEVISTIIDDEAS
GRFDSKTAIPGHVQQGGIPSPMDRVRASRFAIRAVSFIERHSDRCQTFKNSISFRQTDE
ITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNIFWSNVREISDMLSGRTSL
>3opy_H mol:protein length:941  6-phosphofructo-1-kinase beta-subunit
MPDASLFNGTSFITLFAPNISLLQASIDFYTNFLGFAIRKNSNQKLFWLQLEEDQNNVS
IQLILDPEHAASVSQIDQNIRNLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHP
VQQSPNEISPFEVYTVDPLGSLIGFSGFKNPFAVNERSLLPKVSEEKAYRAEDDSEKLL
NPVRKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQ
WHDVRGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRF
RSEWPSLIEELLQTEQISQQQFNTHQNLNICGAVGSIDNDMSSTDATIGAFSSLDRICR
AIDYIDATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEKPASSREWQDQMCD
IVGKHRARGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGT
AVAFDRIYATLQGVEAVNAVLECDADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIE
SRNFKKAISLRDSEFVEHMKNFISTNSADHVPPSLPLEKRKKIAIINVGAPAGGMNSAV
YSMATYCMSRGHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIGTNRTLPNDA
DIGMIAYFFEKYGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPG
TEYSLGSDTCLNSFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISY
VPEEGISLAQLEMDINSLKESFANDQGKTKSGRLILKSENASKVLTTEVISTIIDDEAS
GRFDSKTAIPGHVQQGGIPSPMDRVRASRFAIRAVSFIERHSDRCQTFKNSISFRQTDE
ITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNIFWSNVREISDMLSGRTSL
>3opy_G mol:protein length:989  6-phosphofructo-1-kinase alpha-subunit
MPEPSISDLSFTSFVTNDDNLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIK
EIWLESFPLSEVVEASGGRELRKPLQESVGYESEALLGYSPYQSGGVVIKLRLSNHDLE
KNNDLPGEVTFFTASIDKLKAKLIEIGAEIIPSKIDLVEFSTRDPMGDVISFSSYPSLN
SKKITSPDFFLHPKKEVRSEESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAG
IFYGCKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARCKEFRERWGRLQ
ACYNMVSNGIDALVVCGGDGSLTGADLFRKEWPELIKELLGEDKITKEQYETHRNLTIV
GLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVVEVMGRHCGWLGLM
SGIATGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITS
EEVKDVLVEIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVI
SILENKIVRQPLVESVAQTKTVSAAIEAKDFDKALQLRDQEFATSYENFLSVSKYDDGS
YLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAGLIRHGAVRE
LNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYELD
AARAQYPIFNIPMCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTF
VVEVQGGYSGYLASYAGLITGALAVYTPENPINLQTVQEDIELLTRTYEEDDGKNRSGK
IFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNACRLAIK
CCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSE
VTFTPVKQLWENETHHKWRKGKNVHWEQLNIVSDLLSGRLSIRTT
>3opy_B mol:protein length:941  6-phosphofructo-1-kinase beta-subunit
MPDASLFNGTSFITLFAPNISLLQASIDFYTNFLGFAIRKNSNQKLFWLQLEEDQNNVS
IQLILDPEHAASVSQIDQNIRNLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHP
VQQSPNEISPFEVYTVDPLGSLIGFSGFKNPFAVNERSLLPKVSEEKAYRAEDDSEKLL
NPVRKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQ
WHDVRGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRF
RSEWPSLIEELLQTEQISQQQFNTHQNLNICGAVGSIDNDMSSTDATIGAFSSLDRICR
AIDYIDATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEKPASSREWQDQMCD
IVGKHRARGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGT
AVAFDRIYATLQGVEAVNAVLECDADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIE
SRNFKKAISLRDSEFVEHMKNFISTNSADHVPPSLPLEKRKKIAIINVGAPAGGMNSAV
YSMATYCMSRGHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIGTNRTLPNDA
DIGMIAYFFEKYGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPG
TEYSLGSDTCLNSFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISY
VPEEGISLAQLEMDINSLKESFANDQGKTKSGRLILKSENASKVLTTEVISTIIDDEAS
GRFDSKTAIPGHVQQGGIPSPMDRVRASRFAIRAVSFIERHSDRCQTFKNSISFRQTDE
ITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNIFWSNVREISDMLSGRTSL
>3opy_C mol:protein length:989  6-phosphofructo-1-kinase alpha-subunit
MPEPSISDLSFTSFVTNDDNLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIK
EIWLESFPLSEVVEASGGRELRKPLQESVGYESEALLGYSPYQSGGVVIKLRLSNHDLE
KNNDLPGEVTFFTASIDKLKAKLIEIGAEIIPSKIDLVEFSTRDPMGDVISFSSYPSLN
SKKITSPDFFLHPKKEVRSEESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAG
IFYGCKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARCKEFRERWGRLQ
ACYNMVSNGIDALVVCGGDGSLTGADLFRKEWPELIKELLGEDKITKEQYETHRNLTIV
GLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVVEVMGRHCGWLGLM
SGIATGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITS
EEVKDVLVEIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVI
SILENKIVRQPLVESVAQTKTVSAAIEAKDFDKALQLRDQEFATSYENFLSVSKYDDGS
YLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAGLIRHGAVRE
LNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYELD
AARAQYPIFNIPMCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTF
VVEVQGGYSGYLASYAGLITGALAVYTPENPINLQTVQEDIELLTRTYEEDDGKNRSGK
IFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNACRLAIK
CCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSE
VTFTPVKQLWENETHHKWRKGKNVHWEQLNIVSDLLSGRLSIRTT
>3opy_I mol:protein length:351  6-phosphofructo-1-kinase gamma-subunit
MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFS
RKNDNAPVDKLLTNYYNNYEVNVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDL
PLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPEQYRSSRWEDKVKGPALA
NRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGT
TKKIDLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEG
IPAFRRHEIANFLKKRKTPKNADELIFKYVGRWNICYQKKFHQGNISIHQISGYLD
>3opy_D mol:protein length:941  6-phosphofructo-1-kinase beta-subunit
MPDASLFNGTSFITLFAPNISLLQASIDFYTNFLGFAIRKNSNQKLFWLQLEEDQNNVS
IQLILDPEHAASVSQIDQNIRNLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHP
VQQSPNEISPFEVYTVDPLGSLIGFSGFKNPFAVNERSLLPKVSEEKAYRAEDDSEKLL
NPVRKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQ
WHDVRGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRF
RSEWPSLIEELLQTEQISQQQFNTHQNLNICGAVGSIDNDMSSTDATIGAFSSLDRICR
AIDYIDATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEKPASSREWQDQMCD
IVGKHRARGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGT
AVAFDRIYATLQGVEAVNAVLECDADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIE
SRNFKKAISLRDSEFVEHMKNFISTNSADHVPPSLPLEKRKKIAIINVGAPAGGMNSAV
YSMATYCMSRGHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIGTNRTLPNDA
DIGMIAYFFEKYGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPG
TEYSLGSDTCLNSFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISY
VPEEGISLAQLEMDINSLKESFANDQGKTKSGRLILKSENASKVLTTEVISTIIDDEAS
GRFDSKTAIPGHVQQGGIPSPMDRVRASRFAIRAVSFIERHSDRCQTFKNSISFRQTDE
ITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNIFWSNVREISDMLSGRTSL
>3opy_J mol:protein length:351  6-phosphofructo-1-kinase gamma-subunit
MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFS
RKNDNAPVDKLLTNYYNNYEVNVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDL
PLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPEQYRSSRWEDKVKGPALA
NRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGT
TKKIDLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEG
IPAFRRHEIANFLKKRKTPKNADELIFKYVGRWNICYQKKFHQGNISIHQISGYLD
>3opy_L mol:protein length:351  6-phosphofructo-1-kinase gamma-subunit
MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFS
RKNDNAPVDKLLTNYYNNYEVNVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDL
PLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPEQYRSSRWEDKVKGPALA
NRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGT
TKKIDLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEG
IPAFRRHEIANFLKKRKTPKNADELIFKYVGRWNICYQKKFHQGNISIHQISGYLD
>3opy_E mol:protein length:989  6-phosphofructo-1-kinase alpha-subunit
MPEPSISDLSFTSFVTNDDNLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIK
EIWLESFPLSEVVEASGGRELRKPLQESVGYESEALLGYSPYQSGGVVIKLRLSNHDLE
KNNDLPGEVTFFTASIDKLKAKLIEIGAEIIPSKIDLVEFSTRDPMGDVISFSSYPSLN
SKKITSPDFFLHPKKEVRSEESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAG
IFYGCKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARCKEFRERWGRLQ
ACYNMVSNGIDALVVCGGDGSLTGADLFRKEWPELIKELLGEDKITKEQYETHRNLTIV
GLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVVEVMGRHCGWLGLM
SGIATGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITS
EEVKDVLVEIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVI
SILENKIVRQPLVESVAQTKTVSAAIEAKDFDKALQLRDQEFATSYENFLSVSKYDDGS
YLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAGLIRHGAVRE
LNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYELD
AARAQYPIFNIPMCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTF
VVEVQGGYSGYLASYAGLITGALAVYTPENPINLQTVQEDIELLTRTYEEDDGKNRSGK
IFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNACRLAIK
CCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSE
VTFTPVKQLWENETHHKWRKGKNVHWEQLNIVSDLLSGRLSIRTT
>3opy_A mol:protein length:989  6-phosphofructo-1-kinase alpha-subunit
MPEPSISDLSFTSFVTNDDNLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIK
EIWLESFPLSEVVEASGGRELRKPLQESVGYESEALLGYSPYQSGGVVIKLRLSNHDLE
KNNDLPGEVTFFTASIDKLKAKLIEIGAEIIPSKIDLVEFSTRDPMGDVISFSSYPSLN
SKKITSPDFFLHPKKEVRSEESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAG
IFYGCKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARCKEFRERWGRLQ
ACYNMVSNGIDALVVCGGDGSLTGADLFRKEWPELIKELLGEDKITKEQYETHRNLTIV
GLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVVEVMGRHCGWLGLM
SGIATGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITS
EEVKDVLVEIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVI
SILENKIVRQPLVESVAQTKTVSAAIEAKDFDKALQLRDQEFATSYENFLSVSKYDDGS
YLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAGLIRHGAVRE
LNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYELD
AARAQYPIFNIPMCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTF
VVEVQGGYSGYLASYAGLITGALAVYTPENPINLQTVQEDIELLTRTYEEDDGKNRSGK
IFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNACRLAIK
CCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSE
VTFTPVKQLWENETHHKWRKGKNVHWEQLNIVSDLLSGRLSIRTT
>3opy_K mol:protein length:351  6-phosphofructo-1-kinase gamma-subunit
MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFS
RKNDNAPVDKLLTNYYNNYEVNVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDL
PLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPEQYRSSRWEDKVKGPALA
NRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGT
TKKIDLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEG
IPAFRRHEIANFLKKRKTPKNADELIFKYVGRWNICYQKKFHQGNISIHQISGYLD