>3opy_A mol:protein length:989  6-phosphofructo-1-kinase alpha-subunit
MPEPSISDLSFTSFVTNDDNLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIK
EIWLESFPLSEVVEASGGRELRKPLQESVGYESEALLGYSPYQSGGVVIKLRLSNHDLE
KNNDLPGEVTFFTASIDKLKAKLIEIGAEIIPSKIDLVEFSTRDPMGDVISFSSYPSLN
SKKITSPDFFLHPKKEVRSEESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAG
IFYGCKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARCKEFRERWGRLQ
ACYNMVSNGIDALVVCGGDGSLTGADLFRKEWPELIKELLGEDKITKEQYETHRNLTIV
GLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVVEVMGRHCGWLGLM
SGIATGADYIFIPERPPSESNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITS
EEVKDVLVEIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVI
SILENKIVRQPLVESVAQTKTVSAAIEAKDFDKALQLRDQEFATSYENFLSVSKYDDGS
YLVPESSRLNIAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAGLIRHGAVRE
LNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYELD
AARAQYPIFNIPMCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTF
VVEVQGGYSGYLASYAGLITGALAVYTPENPINLQTVQEDIELLTRTYEEDDGKNRSGK
IFIHNEKASKVYTTDLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNACRLAIK
CCNFIEDANFQVKHNANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSE
VTFTPVKQLWENETHHKWRKGKNVHWEQLNIVSDLLSGRLSIRTT