>3opy_K mol:protein length:351  6-phosphofructo-1-kinase gamma-subunit
MVTKDSIIRDLERENVGPEFGEFLNTLQTDLNSEKPPIEQVKSQLETHFNLAHETQEFS
RKNDNAPVDKLLTNYYNNYEVNVLEFVLQMGFSRDLSIPLNVWFVLDMISQLSTSKQDL
PLDYYLVLNNSQTGKYSDFVRYLIYEAVGAEIHCFEQGSMPEQYRSSRWEDKVKGPALA
NRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGT
TKKIDLLLLTNNFDTNMNNKLQQLKILESLNMLKSNCYVLDYQITVDQVTANFNSYVEG
IPAFRRHEIANFLKKRKTPKNADELIFKYVGRWNICYQKKFHQGNISIHQISGYLD