>3ouy_C mol:na length:35  RNA (35-MER)
GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACCA
>3ouy_D mol:na length:35  RNA (35-MER)
GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACCA
>3ouy_B mol:protein length:437  CCA-Adding Enzyme
MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLE
IDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLK
EPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYGAEYKVRGFSGYLCEL
LIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLA
RFVHLCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYP
QLERASRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERN
VKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFE
IISGEKLFKEPVTAELCEMMGVKD
>3ouy_A mol:protein length:441  CCA-Adding Enzyme
MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLE
IDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLK
EPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYGAEYKVRGFSGYLCEL
LIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLA
RFVHLCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYP
QLERASRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERN
VKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFE
IISGEKLFKEPVTAELCEMMGVKDCCCM
>3ouy_D mol:na length:35  RNA (35-MER)
GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACCA