>3ova_C mol:na length:34  RNA (34-MER)
GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACC
>3ova_C mol:na length:34  RNA (34-MER)
GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACC
>3ova_A mol:protein length:435  CCA-Adding Enzyme
VEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEID
VFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEP
KNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYGAEYKVRGFSGYLCELLI
VFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARF
VHLCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQL
ERASRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVK
KFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEII
SGEKLFKEPVTAELCEMMGVKD