>3ox8_D mol:protein length:275  MHC class I antigen
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEY
WDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAY
DGKDYIALKEDLRSWTAADMAAQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKE
TLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPA
GDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE