>3p1m_H mol:protein length:132  Adrenodoxin, mitochondrial
MSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLI
FEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQS
IDVGKTSAENLYFQ