>3p1x_A mol:protein length:75  Interleukin enhancer-binding factor 3
ILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKA
YAALAALEKLFPDTPL