>3pgw_F mol:protein length:86  Sm-F
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHL
GEVLIRCNNVLYIRGVEEEEEDGEMRE