>3pgw_G mol:protein length:76  Sm G
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGM
VVIRGNSIIMLEALERV