>3pgw_J mol:protein length:76  Sm G
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGM
VVIRGNSIIMLEALERV