>3qir_D mol:protein length:148  Piwi-like protein 2
RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTM
SDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGI
PEKMKKDFRAMKDLAQQINLSPKQHHSALE
>3qir_C mol:protein length:148  Piwi-like protein 2
RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTM
SDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGI
PEKMKKDFRAMKDLAQQINLSPKQHHSALE
>3qir_B mol:protein length:148  Piwi-like protein 2
RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTM
SDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGI
PEKMKKDFRAMKDLAQQINLSPKQHHSALE
>3qir_A mol:protein length:148  Piwi-like protein 2
RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTM
SDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGI
PEKMKKDFRAMKDLAQQINLSPKQHHSALE
>3qir_D mol:protein length:148  Piwi-like protein 2
RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTM
SDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGI
PEKMKKDFRAMKDLAQQINLSPKQHHSALE