>3qte_B mol:protein length:32  Defensin-6
AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL