>3qte_C mol:protein length:32  Defensin-6
AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL