>3qte_D mol:protein length:32  Defensin-6
AFTCHCRRSCYSTEYSYGTCTVMGINWRFCCL