>3rce_A mol:protein length:724  Oligosaccharide transferase to N-glycosylate proteins
MELQQNFTDNNSIKYTCILILIAFAFSVLCRLYWVAWASEFYEFFFNDQLMITTNDGYA
FAEGARDMIAGFHQPNDLSYFGSSLSTLTYWLYSILPFSFESIILYMSTFFASLIVVPI
ILIAREYKLTTYGFIAALLGSIANSYYNRTMSGYYDTDMLVLVLPMLILLTFIRLTINK
DIFTLLLSPIFIMIYLWWYPSSYSLNFAMIGLFGLYTLVFHRKEKIFYLAIALMIIALS
MLAWQYKLALIVLLFAIFAFKEEKINFYMIWALIFISISILHLSGGLDPVLYQLKFYVF
KASDVQNLKDAAFMYFNVNETIMEVNTIDPEVFMQRISSSVLVFILSFIGFILLCKDHK
SMLLALPMLALGFMALRAGLRFTIYAVPVMALGFGYFLYAFFNFLEKKQIKLSLRNKNI
LLILIAFFSISPALMHIYYYKSSTVFTSYEASILNDLKNKAQREDYVVAWWDYGYPIRY
YSDVKTLIDGGKHLGKDNFFSSFVLSKEQIPAANMARLSVEYTEKSFKENYPDVLKAMV
KDYNQTSAKDFLESLNDKNFKFDTNKTRDVYIYMPYRMLRIMPVVAQFANTNPDNGEQE
KSLFFSQANAIAQDKTTGSVMLDNGVEIINDFRALKVEGASIPLKAFVDIESITNGKFY
YNEIDSKAQIYLLFLREYKSFVILDESLYNSAYIQMFLLNQYDQDLFEQVTNDTRAKIY
RLKREFHHHHHHHHHH
>3rce_B mol:protein length:8  Substrate Mimic Peptide
GDQNATFG
>3rce_B mol:protein length:8  Substrate Mimic Peptide
GDQNATFG