>3rcw_E mol:protein length:135  Bromodomain-containing protein 1
SMEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATM
RKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVD
SIGLEEASGMHLPERPA