>3rcw_G mol:protein length:135  Bromodomain-containing protein 1
SMEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATM
RKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVD
SIGLEEASGMHLPERPA