>3rkq_D mol:na length:19  ANF-242 DNA
TCAAGAGGCCCCCACTTCA
>3rkq_A mol:protein length:58  Homeobox protein Nkx-2.5
GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK
>3rkq_B mol:protein length:58  Homeobox protein Nkx-2.5
GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK
>3rkq_C mol:na length:19  ANF-242 DNA
TGAAGTGGGGGCCTCTTGA
>3rkq_D mol:na length:19  ANF-242 DNA
TCAAGAGGCCCCCACTTCA