>3rkq_A mol:protein length:58  Homeobox protein Nkx-2.5
GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK