>3rln_A mol:protein length:200  Gamma-interferon-inducible protein 16
GSVDDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFT
PKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPAGLIASASVTPKINQLCSQTKG
SFVNGVFEVHKKNVRGEFTYYEIQDATGKMEVVVHGRLTTINCEEGDKLKLTCFELAPK
SGNTGELRSVIHSHIKVIKTRKN
>3rln_A mol:protein length:200  Gamma-interferon-inducible protein 16
GSVDDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFT
PKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPAGLIASASVTPKINQLCSQTKG
SFVNGVFEVHKKNVRGEFTYYEIQDATGKMEVVVHGRLTTINCEEGDKLKLTCFELAPK
SGNTGELRSVIHSHIKVIKTRKN