>3rsg_B mol:protein length:6  Unknown peptide, probably from expression host
AWLFEA
>3rsg_B mol:protein length:6  Unknown peptide, probably from expression host
AWLFEA
>3rsg_A mol:protein length:502  Putative uncharacterized protein
MGSDKIHHHHHHMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLC
GGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSIL
NEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVK
ADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERP
RDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELI
SVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVID
ADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVL
KSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGF
AAELFEQDERGLTASELLRLIPEAIRRLKE