>3rt0_A mol:protein length:340  Protein phosphatase 2C 16
SNHLVKGRSVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPS
LTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELSKRNTGEGRQVQWDKV
FTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSR
AVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKP
YVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAER
GKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRKFKTRT