>3s4r_A mol:protein length:93  Vimentin
GSTRTNEKVELQELNDRFANLIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMR
ELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL
>3s4r_B mol:protein length:93  Vimentin
GSTRTNEKVELQELNDRFANLIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMR
ELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL
>3s4r_B mol:protein length:93  Vimentin
GSTRTNEKVELQELNDRFANLIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMR
ELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL