>3sdi_Z mol:protein length:222  Proteasome component C5
QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAA
DGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDG
KGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSV
EEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD