>3sea_B mol:protein length:167  GTP-binding protein Rheb
QSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSADPTIENTFTKLITVNGQEYHLQLVDT
AGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEK