>3sem_B mol:protein length:60  SEX MUSCLE ABNORMAL PROTEIN 5
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNS
N