>3spd_D mol:protein length:204  Aprataxin-like protein
GSHMSFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPL
EIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALANYIKVGFHAGPSMNNL
HLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTSNLPTRGTLTSLFQEDLKCWRCGE
TFGRHFTKLKAHLQEEYDDWLDKSVSM
>3spd_H mol:na length:17  DNA (5'-D(*GP*TP*CP*AP*CP*TP*AP*TP*CP*GP*GP*AP*AP*TP*GP*AP*G)-3')
GTCACTATCGGAATGAG
>3spd_H mol:na length:17  DNA (5'-D(*GP*TP*CP*AP*CP*TP*AP*TP*CP*GP*GP*AP*AP*TP*GP*AP*G)-3')
GTCACTATCGGAATGAG
>3spd_E mol:na length:15  DNA (5'-D(*TP*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*AP*C)-3')
TATTCCGATAGTGAC
>3spd_F mol:na length:17  DNA (5'-D(*GP*TP*CP*AP*CP*TP*AP*TP*CP*GP*GP*AP*AP*TP*GP*AP*G)-3')
GTCACTATCGGAATGAG
>3spd_G mol:na length:15  DNA (5'-D(*TP*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*AP*C)-3')
TATTCCGATAGTGAC
>3spd_C mol:protein length:204  Aprataxin-like protein
GSHMSFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPL
EIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALANYIKVGFHAGPSMNNL
HLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTSNLPTRGTLTSLFQEDLKCWRCGE
TFGRHFTKLKAHLQEEYDDWLDKSVSM
>3spd_B mol:protein length:204  Aprataxin-like protein
GSHMSFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPL
EIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALANYIKVGFHAGPSMNNL
HLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTSNLPTRGTLTSLFQEDLKCWRCGE
TFGRHFTKLKAHLQEEYDDWLDKSVSM
>3spd_A mol:protein length:204  Aprataxin-like protein
GSHMSFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPL
EIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALANYIKVGFHAGPSMNNL
HLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTSNLPTRGTLTSLFQEDLKCWRCGE
TFGRHFTKLKAHLQEEYDDWLDKSVSM