>3spd_B mol:protein length:204  Aprataxin-like protein
GSHMSFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPL
EIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALANYIKVGFHAGPSMNNL
HLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTSNLPTRGTLTSLFQEDLKCWRCGE
TFGRHFTKLKAHLQEEYDDWLDKSVSM