>3t79_A mol:protein length:402  KLLA0E03807p
MSKLDSLLKELPTRTAHLYRSIWHKYTEWLKTMPDLTGADLKLFLSQKYIVKYIASHDD
IAKDPLPTCDAMIWFSRALDIENNDVLVLQQRLYGLVKLLEFDYSNVIAILQKISINLW
NPSTDSLQSKHFKTCQDKLKLLLDFQWKFNTNVSFEDRTTVSLKDLQCILDDENGKCGL
AHSSKPNFVLVPNFQSPFTCPIFTMAVYYYLRFHGVKKYYKGDGYQILSQLEHIPIIRG
KSLDQYPRELTLGNWYPTIFKYCQLPYTKKHWFQVNQEWPQFPDFSDSSENTSTLAESD
SENTIGIPDFYIEKMNRTKLQPCPQVHVHLFPTDLPPDIQAVFDLLNSVLVTSLPLLYR
VFPTHDIFLDPSLKTPQNIAFLTGTLPLDIESQEHLLAQLIDKTGTVS