>3u7u_H mol:protein length:55  Neuregulin 1
GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASF