>3u7u_I mol:protein length:55  Neuregulin 1
GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASF