>3u7u_J mol:protein length:55  Neuregulin 1
GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASF