>3u7u_K mol:protein length:55  Neuregulin 1
GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASF