>3u8m_S mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_I mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_K mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_P mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_L mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_C mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_T mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_O mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_J mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_E mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_T mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_N mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_R mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_M mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_F mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_G mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_Q mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_D mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_B mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_A mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
>3u8m_H mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL