>3u8m_H mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL