>3u8m_I mol:protein length:210  Acetylcholine-binding protein
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIR
QRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVT
QKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL