>3ucz_R mol:na length:92  RNA (92-MER)
GGUCACGCACAGGGCAAACCAUUCGAAAGAGUGGGACGCAAAGCCUCCGGCCUAAACCA
UUGCACUCCGGUAGGUAGCGGGGUUACCGAUGG
>3ucz_D mol:na length:2  RNA (5'-R(*GP*G)-3')
GG
>3ucz_P mol:protein length:98  U1 small nuclear ribonucleoprotein A
MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIF
KEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
>3ucz_D mol:na length:2  RNA (5'-R(*GP*G)-3')
GG