>3ucz_P mol:protein length:98  U1 small nuclear ribonucleoprotein A
MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIF
KEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK