>3uf2_E mol:protein length:153  Macrophage colony-stimulating factor 1
GSHMEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFL
LVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLL
EKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ