>3ugv_A mol:protein length:390  Enolase
MHHHHHHSSGVDLGTENLYFQSMMAQTLTFRKLTARPVLLKLQRPVTARIATIPDWPLI
LIDIETEEGVPGRAYLEPYVPKAMKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFV
GYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKAYNSNGLWLKSPAEVAAE
AVELKAEGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAM
HRTRQIDDLGLEWIEEPVVYDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACD
LVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETAHWLEWQSWADP
ILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLVE