>3ugv_E mol:protein length:390  Enolase
MHHHHHHSSGVDLGTENLYFQSMMAQTLTFRKLTARPVLLKLQRPVTARIATIPDWPLI
LIDIETEEGVPGRAYLEPYVPKAMKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFV
GYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKAYNSNGLWLKSPAEVAAE
AVELKAEGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAM
HRTRQIDDLGLEWIEEPVVYDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACD
LVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETAHWLEWQSWADP
ILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLVE