>3ujg_A mol:protein length:361  Serine/threonine-protein kinase SRK2E
MAHHHHHHADLPIMHDSDRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDE
NVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARF
FFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVG
TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQ
YAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFA
ASDQPGQSIEEIMQIIAEATVPPAGTQNLNHYLTGSLDIDDDMEEDLESDLDDLDIDSS
GEIVYAM