>3uo8_B mol:protein length:390  Mucosa-associated lymphoid tissue lymphoma translocation protein 1
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVD
EFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETG
LNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKF
LKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAES
LVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYV
TDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQ
YSGLEDTVEDKQEVNVGKPLIAKLDMHRLEHHHHHH
>3uo8_L mol:protein length:6  Z-Val-Arg-Pro-DL-Arg-fluoromethylketone
XVRPRX
>3uo8_M mol:protein length:6  Z-Val-Arg-Pro-DL-Arg-fluoromethylketone
XVRPRX
>3uo8_M mol:protein length:6  Z-Val-Arg-Pro-DL-Arg-fluoromethylketone
XVRPRX
>3uo8_C mol:protein length:390  Mucosa-associated lymphoid tissue lymphoma translocation protein 1
MLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVD
EFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETG
LNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKF
LKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAES
LVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYV
TDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQ
YSGLEDTVEDKQEVNVGKPLIAKLDMHRLEHHHHHH