>3urz_B mol:protein length:208  Uncharacterized protein
GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATE
LALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLE
ADNLAANIFLGNYYYLTAEQEKKKLETDYKKLSSPTKMQYARYRDGLSKLFTTRYEKAR
NSLQKVILRFPSTEAQKTLDKILRIEKEVNR
>3urz_A mol:protein length:208  Uncharacterized protein
GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATE
LALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLE
ADNLAANIFLGNYYYLTAEQEKKKLETDYKKLSSPTKMQYARYRDGLSKLFTTRYEKAR
NSLQKVILRFPSTEAQKTLDKILRIEKEVNR
>3urz_B mol:protein length:208  Uncharacterized protein
GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATE
LALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLE
ADNLAANIFLGNYYYLTAEQEKKKLETDYKKLSSPTKMQYARYRDGLSKLFTTRYEKAR
NSLQKVILRFPSTEAQKTLDKILRIEKEVNR