>3uxa_A mol:protein length:252  Kemp eliminase KE59 R1 7/10H
MPRYLKGALKDVVQLSLRRPSLRASRQRPIISLRERILEFNKRNITAIIAVYKRKSPSG
LDVERDPIEYAKFMERYAVGLVILTEEKYFNGSYEDLRKIASSVSIPILMWDFIVKESQ
IDDAYNLGADTVGLIVKILTERELESLLEYARSYGMEPAIVINDEEDLDIALRIGARII
IISSRDLETLEINKENQRKLISMIPSNVVKVAASGISERNEIEELRKLGVNAFEIGSSL
MRNPEKIKELILGSLE