>3v4o_A mol:protein length:245  Mucosa-associated lymphoid tissue lymphoma translocation protein 1
GPGSDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSL
LDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCV
QNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEI
QHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRAL
TDPIQGTEY
>3v4o_B mol:protein length:6  MALT1 Inhibitor
XVRPRX
>3v4o_B mol:protein length:6  MALT1 Inhibitor
XVRPRX