>3v4p_H mol:protein length:219  MONOCLONAL ANTIBODY Act-1 HEAVY CHAIN
QVQLQQPGAELVKPGTSVKLSCKGYGYTFTSYWMHWVKQRPGQGLEWIGEIDPSESNTN
YNQKFKGKATLTVDISSSTAYMQLSSLTSEDSAVYYCARGGYDGWDYAIDYWGQGTSVT
VSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAV
LESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIV