>3v4v_M mol:protein length:219  MONOCLONAL ANTIBODY Act-1 HEAVY CHAIN
QVQLQQPGAELVKPGTSVKLSCKGYGYTFTSYWMHWVKQRPGQGLEWIGEIDPSESNTN
YNQKFKGKATLTVDISSSTAYMQLSSLTSEDSAVYYCARGGYDGWDYAIDYWGQGTSVT
VSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAV
LESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIV