>3vpm_A mol:protein length:286  Ribonucleoside-diphosphate reductase subunit M2
MGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEAVDLSKDIQHWESLKPEE
RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDT
YIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFA
SIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM